PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00140994001
Common NameGSBRNA2T00140994001, LOC106386877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 254aa    MW: 27737.9 Da    PI: 8.5547
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00140994001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-3953110461
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           a++cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknk+s
  GSBRNA2T00140994001  53 LAVRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKRS 110
                          5789****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3148109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3255109IPR003851Zinc finger, Dof-type
PfamPF027019.2E-3455109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDHLLQQQDV FGNYNKAREA MGVTCLSNPT QLDQNEKKPS PETGAARPQP PELAVRCPRC  60
DSTNTKFCYY NNYSLSQPRY FCKSCRRYWT KGGTLRNIPV GGGCRKNKRS ATRSLRTTPE  120
PASHDGKAFS AASFGGYSNN DHIDLSLAFA LLNKQPPGSS SQLGFGSSHQ SDMESVFGTG  180
QQKGNAGYAF ENGCSGLDMA MSDPNKVLWG FPWQVNGERF GMMNMGGGGH VDQLDSGREI  240
WTNMNYINSG ALM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00140994001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2347370.0AC234737.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH010D15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013682148.10.0PREDICTED: dof zinc finger protein DOF5.3-like
SwissprotQ84TE91e-152DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A078C2H40.0A0A078C2H4_BRANA; BnaC03g11340D protein
STRINGBra006675.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-153TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]